PSMD10 anticorps
-
- Antigène Voir toutes PSMD10 Anticorps
- PSMD10 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMD10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV
- Top Product
- Discover our top product PSMD10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMD10 Blocking Peptide, catalog no. 33R-6101, is also available for use as a blocking control in assays to test for specificity of this PSMD10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMD10 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10))
- Autre désignation
- PSMD10 (PSMD10 Produits)
- Synonymes
- anticorps gankyrin, anticorps zgc:109707, anticorps dJ889N15.2, anticorps p28, anticorps p28(GANK), anticorps AW554874, anticorps p28Gank, anticorps proteasome 26S subunit, non-ATPase 10, anticorps proteasome (prosome, macropain) 26S subunit, non-ATPase, 10, anticorps psmd10, anticorps PSMD10, anticorps Psmd10
- Sujet
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Maintenance of Protein Location, Synthesis of DNA, Ubiquitin Proteasome Pathway
-