PPID anticorps
-
- Antigène Voir toutes PPID Anticorps
- PPID (Peptidylprolyl Isomerase D (PPID))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPID est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
- Top Product
- Discover our top product PPID Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPID Blocking Peptide, catalog no. 33R-1762, is also available for use as a blocking control in assays to test for specificity of this PPID antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPID antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPID (Peptidylprolyl Isomerase D (PPID))
- Autre désignation
- PPID (PPID Produits)
- Synonymes
- anticorps PPID, anticorps CYP-40, anticorps CYPD, anticorps Cyp-40, anticorps CypD, anticorps wu:fb18b07, anticorps zgc:86711, anticorps 4930564J03Rik, anticorps Ppidl, anticorps Ppif, anticorps cyp-40, anticorps cypd, anticorps peptidylprolyl isomerase D, anticorps peptidylprolyl isomerase D (cyclophilin D), anticorps peptidylprolyl isomerase D (cyclophilin D) S homeolog, anticorps PPID, anticorps Ppid, anticorps ppid, anticorps ppid.S
- Sujet
- PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Nuclear Hormone Receptor Binding
-