RP2 anticorps
-
- Antigène Voir toutes RP2 Anticorps
- RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG
- Top Product
- Discover our top product RP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RP2 Blocking Peptide, catalog no. 33R-4895, is also available for use as a blocking control in assays to test for specificity of this RP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))
- Autre désignation
- RP2 (RP2 Produits)
- Synonymes
- anticorps Rp2h, anticorps RGD1565124, anticorps RP2, anticorps wu:fj10e02, anticorps wu:fm72d05, anticorps zfrp2, anticorps zgc:55632, anticorps DELXp11.3, anticorps NM23-H10, anticorps NME10, anticorps TBCCD2, anticorps XRP2, anticorps AI662636, anticorps Rp2, anticorps RP2, ARL3 GTPase activating protein, anticorps XRP2 protein, anticorps XRP2-like protein, anticorps retinitis pigmentosa 2 (X-linked recessive), anticorps RP2, ARL3 GTPase activating protein S homeolog, anticorps retinitis pigmentosa 2 homolog, anticorps Rp2, anticorps RP2, anticorps Bm1_36735, anticorps PITG_13367, anticorps LOAG_11813, anticorps rp2, anticorps rp2.S
- Sujet
- The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-