RWDD1 anticorps (Middle Region)

N° du produit ABIN632919

Détail du produit anti-RWDD1 anticorps

Antigène: RWDD1 (RWD Domain Containing 1 (RWDD1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RWDD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RWDD1 antibody was raised against the middle region of RWDD1

Purification: Affinity purified

Immunogène: RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RWDD1 Blocking Peptide, catalog no. 33R-4491, is also available for use as a blocking control in assays to test for specificity of this RWDD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RWDD1

Antigène: RWDD1 (RWD Domain Containing 1 (RWDD1))

Autre désignation: RWDD1 (RWDD1 Produits)

Synonymes: anticorps PTD013, anticorps 0710001K08Rik, anticorps 2610002D06Rik, anticorps 2700069A07Rik, anticorps IH1, anticorps sarip, anticorps RWD domain containing 1, anticorps RWDD1, anticorps Rwdd1

Sujet: The RWDD1 protein protects DRG2 from proteolytic degradation.

Poids moléculaire: 17 kDa (MW of target protein)