EIF3L anticorps (N-Term)

N° du produit ABIN632992

Détail du produit anti-EIF3L anticorps

Antigène: EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF3L est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF3 EIP antibody was raised against the N terminal of EIF3 IP

Purification: Affinity purified

Immunogène: EIF3 EIP antibody was raised using the N terminal of EIF3 IP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3EIP Blocking Peptide, catalog no. 33R-8952, is also available for use as a blocking control in assays to test for specificity of this EIF3EIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 IP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF3L

Antigène: EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))

Autre désignation: EIF3EIP (EIF3L Produits)

Synonymes: anticorps wu:fb66c05, anticorps zgc:64147, anticorps EIF3EIP, anticorps EIF3S11, anticorps EIF3S6IP, anticorps HSPC021, anticorps HSPC025, anticorps MSTP005, anticorps 0610011H21Rik, anticorps D15N1e, anticorps Eif3eip, anticorps Eif3ip, anticorps Eif3s6ip, anticorps HSP-66Y, anticorps PAF67, anticorps eif3eip, anticorps eif3s6ip, anticorps eukaryotic translation initiation factor 3, subunit 6 interacting protein, anticorps eukaryotic translation initiation factor 3 subunit L, anticorps eukaryotic translation initiation factor 3, subunit L, anticorps eukaryotic translation initiation factor 3 subunit L L homeolog, anticorps eif3s6ip, anticorps EIF3L, anticorps Eif3l, anticorps eif3l.L

Sujet: EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization