CCT6B anticorps

N° du produit ABIN633005

Détail du produit anti-CCT6B anticorps

Antigène: CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCT6B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CCT6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCT6B Blocking Peptide, catalog no. 33R-9436, is also available for use as a blocking control in assays to test for specificity of this CCT6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCT6B

Antigène: CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))

Autre désignation: CCT6B (CCT6B Produits)

Synonymes: anticorps CCT-zeta-2, anticorps CCTZ-2, anticorps Cctz2, anticorps TCP-1-zeta-2, anticorps TSA303, anticorps CCTzeta-2, anticorps Cctz-2, anticorps chaperonin containing TCP1 subunit 6B, anticorps T-complex protein 1 subunit zeta-2-like, anticorps t-complex protein 1 subunit zeta-2-like, anticorps chaperonin containing Tcp1, subunit 6b (zeta), anticorps CCT6B, anticorps Cct6b, anticorps LOC100445522, anticorps LOC100616822

Sujet: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

Poids moléculaire: 58 kDa (MW of target protein)