MARK3 anticorps (Middle Region)

N° du produit ABIN633022

Détail du produit anti-MARK3 anticorps

Antigène: MARK3 (MAP/microtubule Affinity-Regulating Kinase 3 (MARK3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MARK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: MARK3 antibody was raised against the middle region of MARK3

Purification: Affinity purified

Immunogène: MARK3 antibody was raised using the middle region of MARK3 corresponding to a region with amino acids ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MARK3 Blocking Peptide, catalog no. 33R-1579, is also available for use as a blocking control in assays to test for specificity of this MARK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MARK3

Antigène: MARK3 (MAP/microtubule Affinity-Regulating Kinase 3 (MARK3))

Autre désignation: MARK3 (MARK3 Produits)

Synonymes: anticorps MARK3, anticorps par1, anticorps par-1, anticorps Par-1A, anticorps CTAK1, anticorps KP78, anticorps PAR1A, anticorps Par-1a, anticorps 1600015G02Rik, anticorps A430080F22Rik, anticorps C-TAK1, anticorps ETK-1, anticorps ETK1, anticorps Emk2, anticorps MPK10, anticorps fi39g08, anticorps wu:fi39g08, anticorps zgc:152848, anticorps zgc:55693, anticorps c-tak1, anticorps ctak1, anticorps emk-2, anticorps microtubule affinity regulating kinase 3, anticorps MAP/microtubule affinity-regulating kinase 3b, anticorps MAP/microtubule affinity regulating kinase 3, anticorps MAP/microtubule affinity-regulating kinase 3a, anticorps microtubule affinity regulating kinase 3 L homeolog, anticorps MARK3, anticorps mark3b, anticorps mark3, anticorps Mark3, anticorps mark3a, anticorps mark3.L

Sujet: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome