CRLF2 anticorps (Middle Region)
-
- Antigène Voir toutes CRLF2 Anticorps
- CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRLF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRLF2 antibody was raised against the middle region of CRLF2
- Purification
- Affinity purified
- Immunogène
- CRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF
- Top Product
- Discover our top product CRLF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRLF2 Blocking Peptide, catalog no. 33R-3132, is also available for use as a blocking control in assays to test for specificity of this CRLF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))
- Autre désignation
- CRLF2 (CRLF2 Produits)
- Synonymes
- anticorps CRLF2, anticorps CRL2, anticorps CRLF2Y, anticorps TSLPR, anticorps CRLM2, anticorps Ly114, anticorps Tpte2, anticorps Tslpr, anticorps Crl2, anticorps cytokine receptor like factor 2, anticorps cytokine receptor-like factor 2, anticorps CRLF2, anticorps Crlf2
- Sujet
- Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.
- Poids moléculaire
- 29 kDa (MW of target protein)
-