CCDC146 anticorps (Middle Region)

N° du produit ABIN633113

Détail du produit anti-CCDC146 anticorps

Antigène: CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC146 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC146 antibody was raised against the middle region of CCDC146

Purification: Affinity purified

Immunogène: CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC146 Blocking Peptide, catalog no. 33R-4337, is also available for use as a blocking control in assays to test for specificity of this CCDC146 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC146 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC146

Antigène: CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))

Autre désignation: CCDC146 (CCDC146 Produits)

Synonymes: anticorps coiled-coil domain containing 146, anticorps CCDC146, anticorps Ccdc146

Sujet: The function of CCDC146 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 113 kDa (MW of target protein)