ZDHHC21 anticorps (Middle Region)
-
- Antigène Voir toutes ZDHHC21 Anticorps
- ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZDHHC21 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZDHHC21 antibody was raised against the middle region of ZDHHC21
- Purification
- Affinity purified
- Immunogène
- ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
- Top Product
- Discover our top product ZDHHC21 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZDHHC21 Blocking Peptide, catalog no. 33R-2559, is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))
- Autre désignation
- ZDHHC21 (ZDHHC21 Produits)
- Synonymes
- anticorps 9130404H11Rik, anticorps AL024349, anticorps D130004H04Rik, anticorps dep, anticorps DHHC-21, anticorps DHHC21, anticorps DNZ1, anticorps HSPC097, anticorps zinc finger DHHC-type containing 21, anticorps zinc finger, DHHC domain containing 21, anticorps zinc finger, DHHC-type containing 21, anticorps ZDHHC21, anticorps zdhhc21, anticorps Zdhhc21
- Sujet
- The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 31 kDa (MW of target protein)
-