BBS4 anticorps (Middle Region)

N° du produit ABIN633149

Détail du produit anti-BBS4 anticorps

Antigène: BBS4 (Bardet-Biedl Syndrome 4 (BBS4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BBS4 est non-conjugé

Application: Western Blotting (WB)

Specificité: BBS4 antibody was raised against the middle region of BBS4

Purification: Affinity purified

Immunogène: BBS4 antibody was raised using the middle region of BBS4 corresponding to a region with amino acids LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BBS4 Blocking Peptide, catalog no. 33R-4978, is also available for use as a blocking control in assays to test for specificity of this BBS4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BBS4

Antigène: BBS4 (Bardet-Biedl Syndrome 4 (BBS4))

Autre désignation: BBS4 (BBS4 Produits)

Synonymes: anticorps CG13232, anticorps Dmel\\CG13232, anticorps zgc:152964, anticorps AW537059, anticorps AW742241, anticorps D9Ertd464e, anticorps Bardet-Biedl syndrome 4, anticorps bardet-biedl syndrome 4, anticorps Bardet-Biedl syndrome 4 (human), anticorps BBS4, anticorps bbs4, anticorps Bbs4

Sujet: This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, Tube Formation, Maintenance of Protein Location