APBB3 anticorps

N° du produit ABIN633150

Détail du produit anti-APBB3 anticorps

Antigène: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APBB3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APBB3 Blocking Peptide, catalog no. 33R-8950, is also available for use as a blocking control in assays to test for specificity of this APBB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APBB3

Antigène: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Autre désignation: APBB3 (APBB3 Produits)

Synonymes: anticorps Fe65l2, anticorps Rirl2, anticorps TR2S, anticorps MGC142933, anticorps FE65L2, anticorps SRA, anticorps amyloid beta (A4) precursor protein-binding, family B, member 3, anticorps steroid receptor RNA activator 1, anticorps amyloid beta precursor protein binding family B member 3, anticorps Apbb3, anticorps SRA1, anticorps APBB3, anticorps apbb3

Sujet: The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

Poids moléculaire: 52 kDa (MW of target protein)