Retinoic Acid Receptor alpha anticorps (N-Term)

N° du produit ABIN633182

Détail du produit anti-Retinoic Acid Receptor alpha anticorps

Antigène: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Retinoic Acid Receptor alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: RARA antibody was raised against the N terminal of RARA

Purification: Affinity purified

Immunogène: RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RARA Blocking Peptide, catalog no. 33R-10090, is also available for use as a blocking control in assays to test for specificity of this RARA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Retinoic Acid Receptor alpha

Antigène: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Autre désignation: RARA (RARA Produits)

Synonymes: anticorps NR1B1, anticorps RAR, anticorps Nr1b1, anticorps RARalpha1, anticorps rar-alpha, anticorps etID309833.12, anticorps rara, anticorps rara2a, anticorps zRAR, anticorps zRAR-alpha, anticorps zgc:109797, anticorps nr1b1, anticorps RAR-ALPHA1, anticorps HS-RARa, anticorps fj66e06, anticorps rara2b, anticorps wu:fj66e06, anticorps retinoic acid receptor alpha, anticorps retinoic acid receptor, alpha, anticorps retinoic acid receptor, alpha a, anticorps retinoic acid receptor alpha L homeolog, anticorps retinoic acid receptor, alpha b, anticorps RARA, anticorps Rara, anticorps LOC100136372, anticorps raraa, anticorps rara.L, anticorps rara, anticorps rarab

Sujet: Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor, which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1, SMRT, and histone deacetylase. When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases, and the basic transcription machinery.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteins