DNA2 anticorps (Middle Region)

N° du produit ABIN633186

Détail du produit anti-DNA2 anticorps

Antigène: DNA2 (DNA Replication Helicase 2 Homolog (DNA2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DNA2 L antibody was raised against the middle region of Dna2

Purification: Affinity purified

Immunogène: DNA2 L antibody was raised using the middle region of Dna2 corresponding to a region with amino acids KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNA2L Blocking Peptide, catalog no. 33R-4506, is also available for use as a blocking control in assays to test for specificity of this DNA2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNA2

Antigène: DNA2 (DNA Replication Helicase 2 Homolog (DNA2))

Autre désignation: DNA2L (DNA2 Produits)

Synonymes: anticorps DNA2L, anticorps Dna2l, anticorps E130315B21Rik, anticorps PEOA6, anticorps hDNA2, anticorps XDna2, anticorps dna2-A, anticorps DNA replication helicase/nuclease 2, anticorps DNA replication helicase/nuclease 2 S homeolog, anticorps DNA2, anticorps Dna2, anticorps dna2.S

Sujet: DNA2L belongs to the DNA2/NAM7 helicase family. It may function in chromosomal DNA replication.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA