SKIV2L anticorps

N° du produit ABIN633197

Détail du produit anti-SKIV2L anticorps

Antigène: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SKIV2L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SKIV2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SKIV2L Blocking Peptide, catalog no. 33R-8835, is also available for use as a blocking control in assays to test for specificity of this SKIV2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SKIV2L

Antigène: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Autre désignation: SKIV2L (SKIV2L Produits)

Synonymes: anticorps 4930534J06Rik, anticorps AW214248, anticorps Ddx13, anticorps SKI, anticorps Ski2w, anticorps 170A, anticorps DDX13, anticorps HLP, anticorps SKI2, anticorps SKI2W, anticorps SKIV2, anticorps THES2, anticorps superkiller viralicidic activity 2-like (S. cerevisiae), anticorps Ski2 like RNA helicase, anticorps Skiv2l, anticorps SKIV2L

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure.

Poids moléculaire: 138 kDa (MW of target protein)