HNRNPC anticorps

N° du produit ABIN633234

Détail du produit anti-HNRNPC anticorps

Antigène: HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPC est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPC Blocking Peptide, catalog no. 33R-4848, is also available for use as a blocking control in assays to test for specificity of this HNRPC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPC

Antigène: HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC))

Autre désignation: HNRPC (HNRNPC Produits)

Synonymes: anticorps C1, anticorps C2, anticorps HNRNP, anticorps HNRPC, anticorps SNRPC, anticorps MGC53243, anticorps HNRNPC, anticorps bZ1G18.4, anticorps fb57h12, anticorps fi16b11, anticorps wu:fb57h12, anticorps wu:fi16b11, anticorps zgc:55701, anticorps AL022939, anticorps D14Wsu171e, anticorps Hnrpc, anticorps Hnrpc1, anticorps Hnrpc2, anticorps hnRNPC1, anticorps hnRNPC2, anticorps hnrnp-C, anticorps hnRNP C, anticorps hnrnp, anticorps hnrpc, anticorps snrpc, anticorps heterogeneous nuclear ribonucleoprotein C (C1/C2), anticorps heterogeneous nuclear ribonucleoprotein C (C1/C2) S homeolog, anticorps heterogeneous nuclear ribonucleoprotein C, anticorps heterogeneous nuclear ribonucleoprotein C (C1/C2) L homeolog, anticorps HNRNPC, anticorps hnrnpc.S, anticorps hnrnpc, anticorps Hnrnpc, anticorps hnrnpc.L

Sujet: HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.

Poids moléculaire: 33 kDa (MW of target protein)