PNPT1 anticorps (Middle Region)

N° du produit ABIN633243

Cet anticorps anti-PNPT1 Polyclonal Lapin (ABIN633243) détecte spécifiquement PNPT1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PNPT1 anticorps (Middle Region) (ABIN633243)

Antigène: PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNPT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PNPT1 anticorps

Épitope: Middle Region

Specificité: PNPT1 antibody was raised against the middle region of PNPT1

Purification: Affinity purified

Immunogène: PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNPT1 Blocking Peptide, (ABIN937084), is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNPT1

Antigène: PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))

Autre désignation: PNPT1

Sujet: PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.

Poids moléculaire: 86 kDa (MW of target protein)