PNPT1 anticorps (Middle Region)
-
- Antigène Voir toutes PNPT1 Anticorps
- PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PNPT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PNPT1 antibody was raised against the middle region of PNPT1
- Purification
- Affinity purified
- Immunogène
- PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
- Top Product
- Discover our top product PNPT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PNPT1 Blocking Peptide, catalog no. 33R-1698, is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))
- Autre désignation
- PNPT1 (PNPT1 Produits)
- Synonymes
- anticorps COXPD13, anticorps DFNB70, anticorps OLD35, anticorps PNPASE, anticorps old-35, anticorps 1200003F12Rik, anticorps Old35, anticorps PNPase, anticorps Pnptl1, anticorps polyribonucleotide nucleotidyltransferase 1, mitochondrial, anticorps polyribonucleotide nucleotidyltransferase 1, anticorps CpipJ_CPIJ005886, anticorps PNPT1, anticorps Pnpt1
- Sujet
- PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.
- Poids moléculaire
- 86 kDa (MW of target protein)
-