SIP1 anticorps (Middle Region)
-
- Antigène Voir toutes SIP1 (GEMIN2) Anticorps
- SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SIP1 antibody was raised against the middle region of SIP1
- Purification
- Affinity purified
- Immunogène
- SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
- Top Product
- Discover our top product GEMIN2 Anticorps primaire
-
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) antibody
GEMIN2 Reactivité: Humain, Souris, Rat IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (C-Term) antibodyGEMIN2 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, ICC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 1-280) antibodyGEMIN2 Reactivité: Humain WB, ELISA, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 1-280) antibodyGEMIN2 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 12-280) antibodyGEMIN2 Reactivité: Humain, Souris, Xenopus laevis WB, ELISA, IF, IP, ICC, FACS Hôte: Souris Monoclonal 2E17 unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) antibodyGEMIN2 Reactivité: Humain WB, IHC Hôte: Lapin Monoclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 51-150) antibodyGEMIN2 Reactivité: Rat WB, ELISA, IF (p), IHC (p), IHC (fro), IF (cc) Hôte: Lapin Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (Middle Region) antibodyGEMIN2 Reactivité: Humain, Souris, Rat, Cheval, Boeuf (Vache), Chien, Lapin, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (N-Term) antibodyGEMIN2 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 35-84) antibodyGEMIN2 Reactivité: Humain, Souris, Rat, Cheval, Boeuf (Vache), Chien, Lapin, Porc, Cobaye, Singe, Roussette (Chauve-souris), Hamster WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SIP1 Blocking Peptide, catalog no. 33R-3856, is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))
- Autre désignation
- SIP1 (GEMIN2 Produits)
- Synonymes
- anticorps SIP1, anticorps SIP1-delta, anticorps 1700012N19Rik, anticorps Sip1, anticorps sip1, anticorps sip1-delta, anticorps wu:fc52a05, anticorps zgc:110274, anticorps gem nuclear organelle associated protein 2, anticorps gem (nuclear organelle) associated protein 2, anticorps gem nuclear organelle associated protein 2 S homeolog, anticorps GEMIN2, anticorps Gemin2, anticorps gemin2.S, anticorps gemin2
- Sujet
- Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Tube Formation
-
