SIP1 anticorps (Middle Region)

N° du produit ABIN633250

Cet anticorps Lapin Polyclonal détecte spécifiquement SIP1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SIP1 anticorps (Middle Region) (ABIN633250)

Antigène: SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIP1 anticorps

Épitope: Middle Region

Specificité: SIP1 antibody was raised against the middle region of SIP1

Purification: Affinity purified

Immunogène: SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIP1 Blocking Peptide, (ABIN939242), is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIP1

Antigène: SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))

Autre désignation: SIP1

Sujet: Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Tube Formation