HDLBP anticorps
-
- Antigène Voir toutes HDLBP Anticorps
- HDLBP (High Density Lipoprotein Binding Protein (HDLBP))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HDLBP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV
- Top Product
- Discover our top product HDLBP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HDLBP Blocking Peptide, catalog no. 33R-8017, is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HDLBP (High Density Lipoprotein Binding Protein (HDLBP))
- Autre désignation
- HDLBP (HDLBP Produits)
- Synonymes
- anticorps HBP, anticorps PRO2900, anticorps VGL, anticorps 1110005P14Rik, anticorps AA960365, anticorps AI118566, anticorps D1Ertd101e, anticorps HDLBP, anticorps vigilin, anticorps cb591, anticorps cb811, anticorps hdlbp, anticorps wu:fb36d01, anticorps wu:fb94h08, anticorps wu:fc23d06, anticorps wu:fc75h07, anticorps high density lipoprotein binding protein, anticorps high density lipoprotein (HDL) binding protein, anticorps vigilin, anticorps high density lipoprotein binding protein (vigilin) S homeolog, anticorps high density lipoprotein binding protein a, anticorps HDLBP, anticorps Hdlbp, anticorps hdlbp.S, anticorps hdlbpa
- Sujet
- HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.
- Poids moléculaire
- 141 kDa (MW of target protein)
-