SRSF11 anticorps (C-Term)
-
- Antigène Voir toutes SRSF11 Anticorps
- SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRSF11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFRS11 antibody was raised against the C terminal of SFRS11
- Purification
- Affinity purified
- Immunogène
- SFRS11 antibody was raised using the C terminal of SFRS11 corresponding to a region with amino acids KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET
- Top Product
- Discover our top product SRSF11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS11 Blocking Peptide, catalog no. 33R-4478, is also available for use as a blocking control in assays to test for specificity of this SFRS11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))
- Autre désignation
- SFRS11 (SRSF11 Produits)
- Synonymes
- anticorps NET2, anticorps SFRS11, anticorps dJ677H15.2, anticorps p54, anticorps 0610009J05Rik, anticorps 2610019N13Rik, anticorps BF642805, anticorps Sfrs11, anticorps serine and arginine rich splicing factor 11, anticorps serine/arginine-rich splicing factor 11, anticorps SRSF11, anticorps Srsf11
- Sujet
- SFRS11 is 54 kDa nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.
- Poids moléculaire
- 53 kDa (MW of target protein)
-