RBM22 anticorps (Middle Region)
-
- Antigène Voir toutes RBM22 Anticorps
- RBM22 (RNA Binding Motif Protein 22 (RBM22))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBM22 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBM22 antibody was raised against the middle region of RBM22
- Purification
- Affinity purified
- Immunogène
- RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
- Top Product
- Discover our top product RBM22 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBM22 Blocking Peptide, catalog no. 33R-3732, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBM22 (RNA Binding Motif Protein 22 (RBM22))
- Autre désignation
- RBM22 (RBM22 Produits)
- Synonymes
- anticorps Cwc2, anticorps ZC3H16, anticorps fSAP47, anticorps 8430430L24Rik, anticorps fb37a01, anticorps zgc:77910, anticorps wu:fb37a01, anticorps wu:fc62e03, anticorps wu:fe05c04, anticorps RBM22, anticorps cg14641, anticorps RNA binding motif protein 22, anticorps RNA binding motif protein 22 S homeolog, anticorps RBM22, anticorps Rbm22, anticorps rbm22, anticorps rbm22.S
- Sujet
- RBM22 may be involved in pre-mRNA splicing.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-