RBMY1A1 anticorps (N-Term)

N° du produit ABIN633380

Détail du produit anti-RBMY1A1 anticorps

Antigène: RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBMY1A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBMY1 A1 antibody was raised against the N terminal of RBMY1 1

Purification: Affinity purified

Immunogène: RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBMY1A1 Blocking Peptide, catalog no. 33R-6530, is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMY0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBMY1A1

Antigène: RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))

Autre désignation: RBMY1A1 (RBMY1A1 Produits)

Synonymes: anticorps RBM, anticorps Rbm1, anticorps Rbm1-rs1, anticorps Rbmy1a1, anticorps Rbmy1a1-rs1, anticorps Rbmy1b, anticorps RBM1, anticorps RBM2, anticorps RBMY, anticorps RBMY1C, anticorps YRRM1, anticorps YRRM2, anticorps RNA binding motif protein, Y chromosome, anticorps RNA binding motif protein, Y-linked, family 1, member A1, anticorps Rbmy, anticorps RBMY1A1

Sujet: RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Poids moléculaire: 41 kDa (MW of target protein)