RBMY1A1 anticorps (N-Term)
-
- Antigène Voir toutes RBMY1A1 Anticorps
- RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBMY1A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBMY1 A1 antibody was raised against the N terminal of RBMY1 1
- Purification
- Affinity purified
- Immunogène
- RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN
- Top Product
- Discover our top product RBMY1A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBMY1A1 Blocking Peptide, catalog no. 33R-6530, is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMY0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))
- Autre désignation
- RBMY1A1 (RBMY1A1 Produits)
- Synonymes
- anticorps RBM, anticorps Rbm1, anticorps Rbm1-rs1, anticorps Rbmy1a1, anticorps Rbmy1a1-rs1, anticorps Rbmy1b, anticorps RBM1, anticorps RBM2, anticorps RBMY, anticorps RBMY1C, anticorps YRRM1, anticorps YRRM2, anticorps RNA binding motif protein, Y chromosome, anticorps RNA binding motif protein, Y-linked, family 1, member A1, anticorps Rbmy, anticorps RBMY1A1
- Sujet
- RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.
- Poids moléculaire
- 41 kDa (MW of target protein)
-