STAU1/Staufen anticorps

N° du produit ABIN633397

Cet anticorps Lapin Polyclonal détecte spécifiquement STAU1/Staufen dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour STAU1/Staufen anticorps (ABIN633397)

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAU1/Staufen est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STAU1/Staufen anticorps

Purification: Affinity purified

Immunogène: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STAU1 Blocking Peptide, (ABIN5616433), is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STAU1/Staufen

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Autre désignation: STAU1

Sujet: This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are haracterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Asymmetric Protein Localization