STAU1/Staufen anticorps
-
- Antigène Voir toutes STAU1/Staufen (STAU1) Anticorps
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STAU1/Staufen est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPI
- Top Product
- Discover our top product STAU1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STAU1 Blocking Peptide, catalog no. 33R-8731, is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
- Autre désignation
- STAU1 (STAU1 Produits)
- Synonymes
- anticorps STAU1, anticorps DKFZp459A0124, anticorps CG5753, anticorps Dmel\\CG5753, anticorps Dmstau, anticorps STAU, anticorps Stau, anticorps Stauf, anticorps dStau, anticorps stau, anticorps XStau, anticorps XStau1, anticorps Staufen, anticorps Staufen1, anticorps MGC145034, anticorps 5830401L18Rik, anticorps AW549911, anticorps C85792, anticorps fi67e05, anticorps wu:fi67e05, anticorps zgc:77271, anticorps staufen double-stranded RNA binding protein 1, anticorps staufen, anticorps RNA binding protein homolog, anticorps staufen (RNA binding protein) homolog 1 (Drosophila), anticorps staufen double-stranded RNA binding protein 1 L homeolog, anticorps STAU1, anticorps stau, anticorps stau1, anticorps STAUFEN, anticorps Stau1, anticorps stau1.L
- Sujet
- This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are haracterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER.
- Poids moléculaire
- 63 kDa (MW of target protein)
- Pathways
- Asymmetric Protein Localization
-