ELAVL4 anticorps (N-Term)
-
- Antigène Voir toutes ELAVL4 Anticorps
- ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ELAVL4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ELAVL4 antibody was raised against the N terminal of ELAVL4
- Purification
- Affinity purified
- Immunogène
- ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
- Top Product
- Discover our top product ELAVL4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ELAVL4 Blocking Peptide, catalog no. 33R-6346, is also available for use as a blocking control in assays to test for specificity of this ELAVL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAVL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))
- Autre désignation
- ELAVL4 (ELAVL4 Produits)
- Synonymes
- anticorps HUD, anticorps PNEM, anticorps HuD, anticorps RGD1561943, anticorps r-HuD, anticorps elrd, anticorps hud, anticorps wu:fc24h01, anticorps Elav, anticorps Hud, anticorps elrD, anticorps elrD1, anticorps elrD2, anticorps ELAV-like protein 4, anticorps ELAV like RNA binding protein 4, anticorps ELAV like neuron-specific RNA binding protein 4, anticorps ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), anticorps ELAV like neuron-specific RNA binding protein 4 L homeolog, anticorps LOC100282339, anticorps LOC100284149, anticorps ELAVL4, anticorps Elavl4, anticorps elavl4, anticorps elavl4.L
- Sujet
- ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
- Poids moléculaire
- 42 kDa (MW of target protein)
-