PUM2 anticorps
-
- Antigène Voir toutes PUM2 Anticorps
- PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PUM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW
- Top Product
- Discover our top product PUM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PUM2 Blocking Peptide, catalog no. 33R-6245, is also available for use as a blocking control in assays to test for specificity of this PUM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))
- Autre désignation
- PUM2 (PUM2 Produits)
- Synonymes
- anticorps pum-2, anticorps 5730503J23Rik, anticorps Pumm2, anticorps mKIAA0235, anticorps PUMH2, anticorps PUML2, anticorps pumilio RNA binding family member 2, anticorps pumilio RNA-binding family member 2, anticorps pum2, anticorps Pum2, anticorps PUM2
- Sujet
- PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts.
- Poids moléculaire
- 114 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-