LARP6 anticorps (Middle Region)

N° du produit ABIN633453

Détail du produit anti-LARP6 anticorps

Antigène: LARP6 (La Ribonucleoprotein Domain Family, Member 6 (LARP6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LARP6 est non-conjugé

Application: Western Blotting (WB)

Specificité: LARP6 antibody was raised against the middle region of LARP6

Purification: Affinity purified

Immunogène: LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LARP6 Blocking Peptide, catalog no. 33R-6082, is also available for use as a blocking control in assays to test for specificity of this LARP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LARP6

Antigène: LARP6 (La Ribonucleoprotein Domain Family, Member 6 (LARP6))

Autre désignation: LARP6 (LARP6 Produits)

Synonymes: anticorps im:7142825, anticorps wu:fa55b04, anticorps ACHN, anticorps 5430431G03Rik, anticorps AI552438, anticorps Achn, anticorps RGD1308414, anticorps La ribonucleoprotein domain family, member 6b, anticorps La ribonucleoprotein domain family member 6, anticorps La ribonucleoprotein domain family, member 6, anticorps larp6b, anticorps LARP6, anticorps Larp6

Sujet: The function of LARP6 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 55 kDa (MW of target protein)