LARP1 anticorps (N-Term)
-
- Antigène Voir toutes LARP1 Anticorps
- LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LARP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LARP1 antibody was raised against the N terminal of LARP1
- Purification
- Affinity purified
- Immunogène
- LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN
- Top Product
- Discover our top product LARP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LARP1 Blocking Peptide, catalog no. 33R-3771, is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
- Autre désignation
- LARP1 (LARP1 Produits)
- Synonymes
- anticorps RGD1306683, anticorps wu:fb92d03, anticorps wu:fd15e07, anticorps 3110040D16RIK, anticorps MGC98945, anticorps LARP, anticorps 1810024J12Rik, anticorps 3110040D16Rik, anticorps Larp, anticorps mKIAA0731, anticorps La ribonucleoprotein domain family, member 1, anticorps La ribonucleoprotein domain family member 1, anticorps La ribonucleoprotein domain family member 1 L homeolog, anticorps Larp1, anticorps larp1, anticorps LARP1, anticorps larp1.L
- Sujet
- LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.
- Poids moléculaire
- 116 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2
-