MSI2 anticorps
-
- Antigène Voir toutes MSI2 Anticorps
- MSI2 (Musashi Homolog 2 (MSI2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MSI2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM
- Top Product
- Discover our top product MSI2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MSI2 Blocking Peptide, catalog no. 33R-2271, is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MSI2 (Musashi Homolog 2 (MSI2))
- Autre désignation
- MSI2 (MSI2 Produits)
- Synonymes
- anticorps MSI2H, anticorps 1700105C15Rik, anticorps AI451722, anticorps AI563628, anticorps AW489193, anticorps Msi2h, anticorps RGD1560397, anticorps MSI2, anticorps musashi-2, anticorps musashi2, anticorps xrp1, anticorps msi2, anticorps zgc:174035, anticorps zgc:63812, anticorps cb746, anticorps fi47b09, anticorps wu:fb02d08, anticorps wu:fi32d12, anticorps wu:fi47b09, anticorps musashi RNA binding protein 2, anticorps musashi RNA-binding protein 2, anticorps musashi RNA binding protein 2 S homeolog, anticorps musashi RNA-binding protein 2b, anticorps musashi RNA-binding protein 2a, anticorps MSI2, anticorps Msi2, anticorps msi2.S, anticorps msi2, anticorps msi2b, anticorps msi2a
- Sujet
- MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Poids moléculaire
- 35 kDa (MW of target protein)
-