KLHL23 anticorps
-
- Antigène Voir toutes KLHL23 Anticorps
- KLHL23 (Kelch-Like 23 (KLHL23))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHL23 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY
- Top Product
- Discover our top product KLHL23 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHL23 Blocking Peptide, catalog no. 33R-9387, is also available for use as a blocking control in assays to test for specificity of this KLHL23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHL23 (Kelch-Like 23 (KLHL23))
- Autre désignation
- KLHL23 (KLHL23 Produits)
- Synonymes
- anticorps DITHP, anticorps C130068N17Rik, anticorps RGD1307166, anticorps Klhl23, anticorps kelch like family member 23, anticorps kelch-like 23, anticorps kelch-like family member 23, anticorps kelch-like protein 23, anticorps kelch-like 23 (Drosophila), anticorps KLHL23, anticorps Klhl23, anticorps LOC488392, anticorps LOC100731969
- Sujet
- This protein mediates protein binding.
- Poids moléculaire
- 64 kDa (MW of target protein)
-