PTBP2 anticorps (N-Term)
-
- Antigène Voir toutes PTBP2 Anticorps
- PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PTBP2 antibody was raised against the N terminal of PTBP2
- Purification
- Affinity purified
- Immunogène
- PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV
- Top Product
- Discover our top product PTBP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTBP2 Blocking Peptide, catalog no. 33R-1284, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))
- Autre désignation
- PTBP2 (PTBP2 Produits)
- Synonymes
- anticorps PTB, anticorps PTBLP, anticorps brPTB, anticorps nPTB, anticorps nPTB5, anticorps nPTB6, anticorps nPTB7, anticorps nPTB8, anticorps Ptb2, anticorps PTBP2, anticorps im:7153495, anticorps ptbp2, anticorps si:ch211-160l17.2, anticorps wu:fa08f05, anticorps wu:fc05d10, anticorps zgc:113074, anticorps polypyrimidine tract binding protein 2, anticorps polypyrimidine tract binding protein 2b, anticorps polypyrimidine tract binding protein 2a, anticorps PTBP2, anticorps Ptbp2, anticorps ptbp2b, anticorps ptbp2a
- Sujet
- The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome
-