NSUN6 anticorps (N-Term)
-
- Antigène Voir toutes NSUN6 Anticorps
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NSUN6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NSUN6 antibody was raised against the N terminal of NSUN6
- Purification
- Affinity purified
- Immunogène
- NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
- Top Product
- Discover our top product NSUN6 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NSUN6 Blocking Peptide, catalog no. 33R-8525, is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
- Autre désignation
- NSUN6 (NSUN6 Produits)
- Synonymes
- anticorps 4933403D21Rik, anticorps 4933414E04Rik, anticorps NOPD1, anticorps Nopd1, anticorps putative methyltransferase NSUN6, anticorps NOL1/NOP2/Sun domain family member 6, anticorps NOP2/Sun RNA methyltransferase family member 6, anticorps NOP2/Sun domain family, member 6, anticorps Tsp_01405, anticorps Nsun6, anticorps NSUN6
- Sujet
- NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.
- Poids moléculaire
- 52 kDa (MW of target protein)
-