PCBP1 anticorps

N° du produit ABIN633568

Détail du produit anti-PCBP1 anticorps

Antigène: PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCBP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCBP1 Blocking Peptide, catalog no. 33R-7142, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCBP1

Antigène: PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))

Autre désignation: PCBP1 (PCBP1 Produits)

Synonymes: anticorps PCBP1, anticorps HNRPE1, anticorps HNRPX, anticorps hnRNP-E1, anticorps hnRNP-X, anticorps hnRNP E1, anticorps WBP17, anticorps [a]CP-1, anticorps alphaCP-1, anticorps RGD1561319, anticorps poly(rC) binding protein 1, anticorps poly(rC) binding protein 1 L homeolog, anticorps poly(rC)-binding protein 1, anticorps PCBP1, anticorps pcbp1.L, anticorps LOC100388387, anticorps Pcbp1

Sujet: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure.

Poids moléculaire: 37 kDa (MW of target protein)