KCNQ1 anticorps (N-Term)

N° du produit ABIN633615

Détail du produit anti-KCNQ1 anticorps

Antigène: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNQ1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNQ1 antibody was raised against the N terminal of KCNQ1

Purification: Affinity purified

Immunogène: KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNQ1 Blocking Peptide, catalog no. 33R-8193, is also available for use as a blocking control in assays to test for specificity of this KCNQ1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNQ1

Antigène: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Autre désignation: KCNQ1 (KCNQ1 Produits)

Synonymes: anticorps ATFB1, anticorps ATFB3, anticorps JLNS1, anticorps KCNA8, anticorps KCNA9, anticorps KVLQT1, anticorps Kv1.9, anticorps Kv7.1, anticorps LQT, anticorps LQT1, anticorps RWS, anticorps SQT2, anticorps WRS, anticorps CG12215, anticorps CG12915, anticorps CG33135, anticorps DKCNQ, anticorps Dmel\\CG33135, anticorps dKCNQ, anticorps kcnq1, anticorps KCNQ1, anticorps kqt-3, anticorps kv7.1, anticorps Kvlqt1, anticorps KvLQT-1, anticorps kcnq1-A, anticorps xkvlqt1, anticorps zgc:158384, anticorps AW559127, anticorps Kcna9, anticorps KvLQT1, anticorps potassium voltage-gated channel subfamily Q member 1, anticorps KCNQ potassium channel, anticorps potassium voltage-gated channel, KQT-like subfamily, member 1, anticorps potassium channel, voltage gated KQT-like subfamily Q, member 1, anticorps voltage gated potassium channel subunit, anticorps potassium channel, voltage gated KQT-like subfamily Q, member 1 L homeolog, anticorps potassium voltage-gated channel, subfamily Q, member 1, anticorps KCNQ1, anticorps KCNQ, anticorps kcnq1, anticorps Kcnq1, anticorps kcnq1.L

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Sensory Perception of Sound