CACNB4 anticorps (C-Term)
-
- Antigène Voir toutes CACNB4 Anticorps
- CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACNB4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACNB4 antibody was raised against the C terminal of CACNB4
- Purification
- Affinity purified
- Immunogène
- CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
- Top Product
- Discover our top product CACNB4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACNB4 Blocking Peptide, catalog no. 33R-4882, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))
- Autre désignation
- CACNB4 (CACNB4 Produits)
- Synonymes
- anticorps CAB4, anticorps CACNLB4, anticorps EA5, anticorps EIG9, anticorps EJM, anticorps EJM4, anticorps EJM6, anticorps 3110038O15Rik, anticorps Cchb4, anticorps lethargic, anticorps lh, anticorps CACNB4, anticorps cacnb4.2, anticorps calcium voltage-gated channel auxiliary subunit beta 4, anticorps calcium channel, voltage-dependent, beta 4 subunit, anticorps calcium channel, voltage-dependent, beta 4a subunit, anticorps CACNB4, anticorps Cacnb4, anticorps cacnb4.1, anticorps cacnb4, anticorps cacnb4a
- Sujet
- CACNB4 is a member of the beta subunit family, a protein in the voltage-dependent calcium channel complex. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, Skeletal Muscle Fiber Development
-