VDAC3 anticorps (N-Term)

N° du produit ABIN633623

Détail du produit anti-VDAC3 anticorps

Antigène: VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VDAC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: VDAC3 antibody was raised against the N terminal of VDAC3

Purification: Affinity purified

Immunogène: VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VDAC3 Blocking Peptide, catalog no. 33R-8339, is also available for use as a blocking control in assays to test for specificity of this VDAC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VDAC3

Antigène: VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))

Autre désignation: VDAC3 (VDAC3 Produits)

Synonymes: anticorps HD-VDAC3, anticorps VDAC-3, anticorps VDAC1P5, anticorps VDAC5P, anticorps VDAC3, anticorps wu:fb01e12, anticorps zgc:77898, anticorps hd-vdac3, anticorps ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3, anticorps ATVDAC3, anticorps AtVDAC3, anticorps Athsr2, anticorps F2G14.210, anticorps F2G14_210, anticorps voltage dependent anion channel 3, anticorps voltage dependent anion channel 3, anticorps voltage-dependent anion channel 3, anticorps voltage-dependent anion channel 3 L homeolog, anticorps VDAC3, anticorps Vdac3, anticorps vdac3, anticorps vdac3.L

Sujet: VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase.

Poids moléculaire: 31 kDa (MW of target protein)