KCTD19 anticorps (N-Term)
-
- Antigène Tous les produits KCTD19
- KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD19 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD19 antibody was raised against the n terminal of KCTD19
- Purification
- Affinity purified
- Immunogène
- KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD19 Blocking Peptide, catalog no. 33R-2168, is also available for use as a blocking control in assays to test for specificity of this KCTD19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))
- Autre désignation
- KCTD19 (KCTD19 Produits)
- Synonymes
- anticorps 4922504H04Rik, anticorps potassium channel tetramerisation domain containing 19, anticorps potassium channel tetramerization domain containing 19, anticorps Kctd19, anticorps KCTD19
- Sujet
- The function of KCTD19 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 102 kDa (MW of target protein)
-