CACNA2D1 anticorps (Middle Region)

N° du produit ABIN633675

Détail du produit anti-CACNA2D1 anticorps

Antigène: CACNA2D1 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNA2D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNA2 D1 antibody was raised against the middle region of CACNA2 1

Purification: Affinity purified

Immunogène: CACNA2 D1 antibody was raised using the middle region of CACNA2 1 corresponding to a region with amino acids PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI

Information d'application

Indications d'application: WB: 0.12 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNA2D1 Blocking Peptide, catalog no. 33R-7178, is also available for use as a blocking control in assays to test for specificity of this CACNA2D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNA2D1

Antigène: CACNA2D1 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1))

Autre désignation: CACNA2D1 (CACNA2D1 Produits)

Synonymes: anticorps CACNA2D1, anticorps DKFZp469K2211, anticorps CACNA2, anticorps CACNL2A, anticorps CCHL2A, anticorps Ca(v)alpha2delta1, anticorps Cacna2, anticorps Cchl2a, anticorps CCHLA2, anticorps DHSCCA, anticorps calcium voltage-gated channel auxiliary subunit alpha2delta 1, anticorps calcium channel, voltage-dependent, alpha 2/delta subunit 1, anticorps calcium channel, voltage-dependent, alpha2/delta subunit 1, anticorps CACNA2D1, anticorps cacna2d1, anticorps Cacna2d1

Sujet: CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.

Poids moléculaire: 120 kDa (MW of target protein)