KCNN2 anticorps (Middle Region)
-
- Antigène Voir toutes KCNN2 Anticorps
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNN2 antibody was raised against the middle region of KCNN2
- Purification
- Affinity purified
- Immunogène
- KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
- Top Product
- Discover our top product KCNN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNN2 Blocking Peptide, catalog no. 33R-4564, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
- Autre désignation
- KCNN2 (KCNN2 Produits)
- Synonymes
- anticorps KCNN2, anticorps SK2, anticorps KCa2.2, anticorps SKCA2, anticorps SKCa 2, anticorps hSK2, anticorps fri, anticorps potassium calcium-activated channel subfamily N member 2, anticorps potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2, anticorps KCNN2, anticorps Kcnn2
- Sujet
- KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.
- Poids moléculaire
- 26 kDa (MW of target protein)
-