Kv2.1/KCNB1 anticorps (Middle Region)
-
- Antigène Voir toutes Kv2.1/KCNB1 (KCNB1) Anticorps
- Kv2.1/KCNB1 (KCNB1) (Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Kv2.1/KCNB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNB1 antibody was raised against the middle region of KCNB1
- Purification
- Affinity purified
- Immunogène
- KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT
- Top Product
- Discover our top product KCNB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNB1 Blocking Peptide, catalog no. 33R-10132, is also available for use as a blocking control in assays to test for specificity of this KCNB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Kv2.1/KCNB1 (KCNB1) (Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1))
- Autre désignation
- KCNB1 (KCNB1 Produits)
- Synonymes
- anticorps KCNB1, anticorps Kcnb1, anticorps Kcr1-1, anticorps Kv2.1, anticorps Shab, anticorps DRK1PC, anticorps DRK1, anticorps KV2.1, anticorps h-DRK1, anticorps potassium voltage-gated channel subfamily B member 1, anticorps potassium voltage-gated channel, Shab-related subfamily, member 1, anticorps potassium channel, voltage gated Shab related subfamily B, member 1, anticorps potassium voltage gated channel, Shab-related subfamily, member 1, anticorps KCNB1, anticorps kcnb1, anticorps LOC100541632, anticorps Kcnb1
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).
- Poids moléculaire
- 96 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-