KCNA7 anticorps (C-Term)

N° du produit ABIN633690

Détail du produit anti-KCNA7 anticorps

Antigène: KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA7 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNA7 antibody was raised against the C terminal of KCNA7

Purification: Affinity purified

Immunogène: KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNA7 Blocking Peptide, catalog no. 33R-3222, is also available for use as a blocking control in assays to test for specificity of this KCNA7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNA7

Antigène: KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))

Autre désignation: KCNA7 (KCNA7 Produits)

Synonymes: anticorps hak6, anticorps kv1.7, anticorps XKv1.10, anticorps kvl10-A, anticorps HAK6, anticorps KV1.7, anticorps Kv1.7, anticorps potassium channel, voltage gated shaker related subfamily A, member 7 S homeolog, anticorps potassium voltage-gated channel subfamily A member 7, anticorps potassium voltage-gated channel, shaker-related subfamily, member 7, anticorps kcna7.S, anticorps KCNA7, anticorps Kcna7

Sujet: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Poids moléculaire: 50 kDa (MW of target protein)