KCNMA1 anticorps (Middle Region)

N° du produit ABIN633699

Détail du produit anti-KCNMA1 anticorps

Antigène: KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNMA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNMA1 antibody was raised against the middle region of KCNMA1

Purification: Affinity purified

Immunogène: KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNMA1 Blocking Peptide, catalog no. 33R-2744, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNMA1

Antigène: KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))

Autre désignation: KCNMA1 (KCNMA1 Produits)

Synonymes: anticorps BKTM, anticorps KCa1.1, anticorps MaxiK, anticorps SAKCA, anticorps SLO, anticorps SLO-ALPHA, anticorps SLO1, anticorps bA205K10.1, anticorps mSLO1, anticorps DDBDRAFT_0190653, anticorps DDBDRAFT_0235401, anticorps DDB_0190653, anticorps DDB_0235401, anticorps KCNMA, anticorps KCNMA1, anticorps 5730414M22Rik, anticorps BKCa, anticorps Slo, anticorps Slo1, anticorps mSlo, anticorps mSlo1, anticorps KCNMA1b, anticorps KCNMA1c, anticorps Kcnma, anticorps bktm, anticorps kcnma1-A, anticorps sakca, anticorps cSlo, anticorps slo1, anticorps kcnma1, anticorps si:ch211-39f22.2, anticorps BcDNA:GH10751, anticorps CG10693, anticorps Dmel\CG10693, anticorps Dslo, anticorps dSlo, anticorps dSlo1, anticorps dslo, anticorps fSlo, anticorps potassium calcium-activated channel subfamily M alpha 1, anticorps calcium-activated BK potassium channel, alpha subunit, anticorps potassium large conductance calcium-activated channel, subfamily M, alpha member 1, anticorps potassium calcium-activated channel subfamily M alpha 1 L homeolog, anticorps potassium large conductance calcium-activated channel, subfamily M, alpha member 1a, anticorps calcium-activated potassium channel subunit alpha-1, anticorps slowpoke, anticorps KCNMA1, anticorps kcnma1, anticorps Kcnma1, anticorps kcnma1.L, anticorps kcnma1a, anticorps LOC100454095, anticorps slo

Sujet: This protein is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.

Poids moléculaire: 131 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Sensory Perception of Sound