TRPC4 anticorps (Middle Region)

N° du produit ABIN633715

Détail du produit anti-TRPC4 anticorps

Antigène: TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPC4 antibody was raised against the middle region of TRPC4

Purification: Affinity purified

Immunogène: TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPC4 Blocking Peptide, catalog no. 33R-1763, is also available for use as a blocking control in assays to test for specificity of this TRPC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPC4

Antigène: TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))

Autre désignation: TRPC4 (TRPC4 Produits)

Synonymes: anticorps TRPC5, anticorps TRPC4, anticorps HTRP-4, anticorps HTRP4, anticorps TRP4, anticorps CCE1, anticorps STRPC4, anticorps Trp4, anticorps Trrp4, anticorps transient receptor potential cation channel subfamily C member 4, anticorps short transient receptor potential channel 4, anticorps transient receptor potential cation channel, subfamily C, member 4, anticorps TRPC4, anticorps LOC100538928, anticorps trpc4, anticorps Trpc4

Sujet: TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.

Poids moléculaire: 112 kDa (MW of target protein)