KCNA1 anticorps (Middle Region)

N° du produit ABIN633721

Détail du produit anti-KCNA1 anticorps

Antigène: KCNA1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (KCNA1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNA1 antibody was raised against the middle region of KCNA1

Purification: Affinity purified

Immunogène: KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNA1 Blocking Peptide, catalog no. 33R-4154, is also available for use as a blocking control in assays to test for specificity of this KCNA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNA1

Antigène: KCNA1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (KCNA1))

Autre désignation: KCNA1 (KCNA1 Produits)

Synonymes: anticorps AEMK, anticorps EA1, anticorps HBK1, anticorps HUK1, anticorps KV1.1, anticorps MBK1, anticorps MK1, anticorps RBK1, anticorps KCNA1, anticorps AI840627, anticorps Kca1-1, anticorps Kv1.1, anticorps Mk-1, anticorps Shak, anticorps mceph, anticorps Kcna, anticorps Kcpvd, anticorps potassium voltage-gated channel subfamily A member 1, anticorps potassium voltage-gated channel, shaker-related subfamily, member 1, anticorps fragile site, aphidicolin type, common, fra(12)(q24), anticorps KCNA1, anticorps Kcna1, anticorps FRA12E

Sujet: KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

Poids moléculaire: 56 kDa (MW of target protein)