TRPM4 anticorps (N-Term)

N° du produit ABIN633730

Détail du produit anti-TRPM4 anticorps

Antigène: TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPM4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPM4 antibody was raised against the N terminal of TRPM4

Purification: Affinity purified

Immunogène: TRPM4 antibody was raised using the N terminal of TRPM4 corresponding to a region with amino acids ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPM4 Blocking Peptide, catalog no. 33R-2560, is also available for use as a blocking control in assays to test for specificity of this TRPM4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPM4

Antigène: TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))

Autre désignation: TRPM4 (TRPM4 Produits)

Synonymes: anticorps PFHB1B, anticorps TRPM4B, anticorps LTrpC-4, anticorps Mls2s, anticorps 1110030C19Rik, anticorps AW047689, anticorps LTRPC4, anticorps TRPM4, anticorps transient receptor potential cation channel subfamily M member 4, anticorps transient receptor potential cation channel, subfamily M, member 4, anticorps TRPM4, anticorps Trpm4

Sujet: TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production.

Poids moléculaire: 134 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response