GRIN2B anticorps (Middle Region)

N° du produit ABIN633768

Détail du produit anti-GRIN2B anticorps

Antigène: GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRIN2B est non-conjugé

Application: Western Blotting (WB)

Specificité: GRIN2 B antibody was raised against the middle region of GRIN2

Purification: Affinity purified

Immunogène: GRIN2 B antibody was raised using the middle region of GRIN2 corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRIN2B Blocking Peptide, catalog no. 33R-8201, is also available for use as a blocking control in assays to test for specificity of this GRIN2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRIN2B

Antigène: GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))

Autre désignation: GRIN2B (GRIN2B Produits)

Synonymes: anticorps NMDAR2B, anticorps GluN2B, anticorps MRD6, anticorps NR2B, anticorps hNR3, anticorps nmdar2b, anticorps nr2b, anticorps AW490526, anticorps Nmdar2b, anticorps glutamate ionotropic receptor NMDA type subunit 2B, anticorps glutamate receptor, ionotropic, N-methyl D-aspartate 2B L homeolog, anticorps glutamate receptor, ionotropic, NMDA2B (epsilon 2), anticorps GRIN2B, anticorps Grin2b, anticorps grin2b.L

Sujet: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning.

Poids moléculaire: 163 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Synaptic Membrane, Feeding Behaviour, Regulation of long-term Neuronal Synaptic Plasticity