CHRFAM7A anticorps (Middle Region)
-
- Antigène Voir toutes CHRFAM7A Anticorps
- CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHRFAM7A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHRFAM7 A antibody was raised against the middle region of CHRFAM7
- Purification
- Affinity purified
- Immunogène
- CHRFAM7 A antibody was raised using the middle region of CHRFAM7 corresponding to a region with amino acids QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
- Top Product
- Discover our top product CHRFAM7A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHRFAM7A Blocking Peptide, catalog no. 33R-7718, is also available for use as a blocking control in assays to test for specificity of this CHRFAM7A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRFAM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))
- Autre désignation
- CHRFAM7A (CHRFAM7A Produits)
- Synonymes
- anticorps CHRNA7, anticorps CHRNA7-DR1, anticorps D-10, anticorps CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion, anticorps CHRFAM7A
- Sujet
- The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A. The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A).
- Poids moléculaire
- 35 kDa (MW of target protein)
-