SCN1B anticorps (Middle Region)

N° du produit ABIN633779

Détail du produit anti-SCN1B anticorps

Antigène: SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCN1B est non-conjugé

Application: Western Blotting (WB)

Specificité: SCN1 B antibody was raised against the middle region of SCN1

Purification: Affinity purified

Immunogène: SCN1 B antibody was raised using the middle region of SCN1 corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCN1B Blocking Peptide, catalog no. 33R-6928, is also available for use as a blocking control in assays to test for specificity of this SCN1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCN1B

Antigène: SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))

Autre désignation: SCN1B (SCN1B Produits)

Synonymes: anticorps GEFSP1, anticorps sodium channel, voltage-gated, type I, beta, anticorps sodium voltage-gated channel beta subunit 1, anticorps Scn1b, anticorps SCN1B

Sujet: Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.

Poids moléculaire: 25 kDa (MW of target protein)