SCN3B anticorps (N-Term)

N° du produit ABIN633798

Détail du produit anti-SCN3B anticorps

Antigène: SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))

Épitope: N-Term

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCN3B est non-conjugé

Application: Western Blotting (WB)

Specificité: SCN3 B antibody was raised against the N terminal of SCN3

Purification: Affinity purified

Immunogène: SCN3 B antibody was raised using the N terminal of SCN3 corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCN3B Blocking Peptide, catalog no. 33R-8090, is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCN3B

Antigène: SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))

Autre désignation: SCN3B (SCN3B Produits)

Synonymes: anticorps 1110001K16Rik, anticorps 4833414B02Rik, anticorps Scnb3, anticorps HSA243396, anticorps SCNB3, anticorps sodium voltage-gated channel beta subunit 3, anticorps sodium channel, voltage-gated, type III, beta, anticorps SCN3B, anticorps Scn3b

Sujet: SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.

Poids moléculaire: 24 kDa (MW of target protein)