GNAO1 anticorps (Middle Region)

N° du produit ABIN633809

Détail du produit anti-GNAO1 anticorps

Antigène: GNAO1 (Guanine Nucleotide Binding Protein (G Protein), alpha Activating Activity Polypeptide O (GNAO1))

Épitope: Middle Region

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GNAO1 antibody was raised against the middle region of Gnao1

Purification: Affinity purified

Immunogène: GNAO1 antibody was raised using the middle region of Gnao1 corresponding to a region with amino acids CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNAO1 Blocking Peptide, catalog no. 33R-1672, is also available for use as a blocking control in assays to test for specificity of this GNAO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNAO1

Antigène: GNAO1 (Guanine Nucleotide Binding Protein (G Protein), alpha Activating Activity Polypeptide O (GNAO1))

Autre désignation: GNAO1 (GNAO1 Produits)

Synonymes: anticorps G-ALPHA-o, anticorps GNAO, anticorps AW050213, anticorps Galphao, anticorps Gnao, anticorps alphaO, anticorps gnao1, anticorps wu:fq26h05, anticorps zgc:73315, anticorps RATBPGTPC, anticorps XGalpha01, anticorps gnao1-A, anticorps zgc:73153, anticorps G protein subunit alpha o1, anticorps guanine nucleotide binding protein, alpha O, anticorps guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a, anticorps G protein subunit alpha o1 L homeolog, anticorps Guanine nucleotide-binding protein G(o) subunit alpha, anticorps guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b, anticorps GNAO1, anticorps Gnao1, anticorps gnao1a, anticorps gnao1.L, anticorps goa-1, anticorps gnao1b

Sujet: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: G-protein mediated Events