TMOD2 anticorps
-
- Antigène Voir toutes TMOD2 Anticorps
- TMOD2 (Tropomodulin 2 (TMOD2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMOD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED
- Top Product
- Discover our top product TMOD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tropomodulin 2 Blocking Peptide, catalog no. 33R-4840, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMOD2 (Tropomodulin 2 (TMOD2))
- Autre désignation
- Tropomodulin 2 (TMOD2 Produits)
- Synonymes
- anticorps zgc:86648, anticorps N-Tmod, anticorps NTMOD, anticorps N-TMOD, anticorps tropomodulin 2, anticorps tmod2, anticorps Tmod2, anticorps TMOD2
- Sujet
- TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-